Skip to content

inquiry

/ɪnˈkwaɪ(ə)ɹi/noun3 syllables

Inquiry means: an instance of questioning.

Synonyms for inquiry5

noun, as in an instance of questioning

question, enquiry, query, interrogation

noun, as in a search for knowledge

enquiry, research

noun, as in a systematic investigation of a matter of public interest

enquiry

What does inquiry mean?3

noun

1

an instance of questioning“there was a question about my training”

2

a search for knowledge“their pottery deserves more research than it has received”

3

a systematic investigation of a matter of public interest

Definitions from the Open English WordNet, CC BY 4.0.

What rhymes with inquiry?2

three syllables

enquiryexpiry
Show 40 near rhymes
likelyfridayhighlyslightlytinywidelyunlikelyhawaiipreciselymightynicelykindlylightlyrileynikeshinylivelytimelyivyspicyhygienetightlyrightlyalmightyninetywildlywiselycrisesicykylietidyfinelynightlypolitelybrightlymildlypsychesmileypriceyblindly

Inquiry in a sentence

  • What is your field of study, your domain of inquiry, your major interest?halfb1t
  • For media inquiries, please contact your local communications or marketing representative.LeviHighway
  • This subject is outside the scope of our inquiry.AlanF_US
  • He wrote a letter of inquiry to his business contact.unknown
  • The inquiry has been cranked up a notch.sacredceltic
  • Every art and every inquiry seem to aim at some good.JMLlovet
  • Every experience is worthy of inquiry and deeper understanding and love.carlosalberto
  • He gave an expeditious answer to an inquiry.Tanikaz

Sentences from Tatoeba, CC BY 2.0 FR, credited to their authors.

Forms of inquiry

as a noun

plural
inquiries