Skip to content

Word lists

3-Letter Words Starting With Y

27 3-letter words start with the letter Y, including you, yet, yes, yep. Every word below is valid in Scrabble-style word games.

Highest scoring

  • yak10
  • yok10
  • yuk10
  • yah9
  • yaw9
  • yay9
  • yeh9
  • yew9

Standard letter values, public-domain ENABLE list, not the official tournament dictionary.

The full list27

yahyakyamyapyaryawyayyeayehyenyepyesyetyewyidyinyipyobyodyokyomyonyouyowyukyumyup