Skip to content

Word lists

4-Letter Words Starting With Y

70 4-letter words start with the letter Y, including your, year, yeah, yard. Every word below is valid in Scrabble-style word games.

Highest scoring

  • yack13
  • yaff13
  • yock13
  • yuck13
  • yawp12
  • yech12
  • yuch12
  • yaks11

Standard letter values, public-domain ENABLE list, not the official tournament dictionary.

The full list70

yackyaffyagiyaksyaldyamsyangyankyapsyardyareyarnyaudyaupyawlyawnyawpyawsyaysyeahyeanyearyeasyechyeggyeldyelkyellyelpyensyerkyetiyettyeukyewsyidsyillyinsyipeyipsyirdyirrylemyobsyockyodhyodsyogayoghyogiyokeyoksyolkyondyoniyoreyouryoweyowlyowsyuanyucayuchyuckyugayuksyuleyupsyurtywis