Skip to content

Word lists

5-Letter Words Starting With P

565 5-letter words start with the letter P, including place, point, power, party. Every word below is valid in Scrabble-style word games.

Highest scoring

  • pizza25
  • pawky17
  • phlox17
  • prexy17
  • proxy17
  • pujah17
  • pyxes17
  • pyxie17

Standard letter values, public-domain ENABLE list, not the official tournament dictionary.

The full list565

pacaspacedpacerpacespachapackspactspaddypadispadlepadrepadripaeanpaeonpaganpagedpagerpagespagodpaikspailspainspaintpairspaisapaisepaleapaledpalerpalespaletpallspallypalmspalmypalpipalpspalsypampapandapandypanedpanelpanespangapangspanicpannepansypantopantspantypapalpapaspapawpaperpappipappyparasparchpardipardspardyparedpareoparerparespareupargepargoparisparkaparksparleparolparrsparryparsepartspartyparveparvopaseopasespashapassepastapastepastspastypatchpatedpatenpaterpatespathspatinpatiopatlypatsypattypausepavanpavedpaverpavespavidpavinpavispawedpawerpawkypawlspawnspaxespayedpayeepayerpayorpeacepeachpeagepeagspeakspeakypealspeanspearlpearspeartpeasepeatspeatypeavypecanpechspeckspeckypedalpedespedropeekspeelspeenspeepspeerspeerypeevepeinspeisepekanpekespekinpekoepelespelfspelonpeltspenalpencependspenespengopenispennapennepennipennypeonspeonypeplapepospeppyperchperduperdypereaperilperisperksperkypermsperrypersepeskypesospestopestspestypetalpeterpetitpettipettopettypeweepewitphagephasephialphloxphonephonophonsphonyphotophotsphphtphutsphylaphylepianopianspibalpicalpicaspickspickypicotpiculpiecepierspietapietypiggypigmypiingpikaspikedpikerpikespikispilafpilarpilaupilawpileapiledpileipilespilispillspilotpiluspimaspimpspinaspinchpinedpinespineypingopingspinkopinkspinkypinnapinnypinonpinotpintapintopintspinuppionspiouspipalpipedpiperpipespipetpipitpiquepirnspirogpiscopisospistepitaspitchpithspithypitonpivotpixelpixespixiepizzaplaceplackplageplaidplainplaitplaneplankplansplantplashplasmplateplatsplatyplayaplaysplazapleadpleaspleatplebeplebsplenaplewsplicapliedplierpliesplinkplodsplonkplopsplotsplotzplowsployspluckplugsplumbplumeplumpplumsplumyplunkplushplyerpoachpockspockypodgypodiapoemspoesypoetspogeypoilupoindpointpoisepokedpokerpokespokeypolarpoledpolerpolespoliopolispolkapollspolospolyppolyspomespommypompsponcepondsponespongspoochpoodspoofspoofypoohspoolspoonspoopspooripoovepopespoppapoppypopsyporchporedporesporgyporksporkypornopornspornyportsposedposerposespositpossepostspotsypottopottypouchpouffpoufspoultpoundpourspoutspoutypowerpoxedpoxespoyoupraamprahupramsprangprankpraosprasepratepratsprausprawnprayspreedpreenpreesprepspresapresepressprestprexypreyspriceprickpricypridepriedprierpriesprigsprillprimaprimeprimiprimoprimpprimsprinkprintprionpriorpriseprismprissprivyprizeproasprobeprodsproemprofsprogsprolepromopromsproneprongproofpropsproseprosoprossprostprosyproudproveprowlprowsproxyprudepruneprutapryerpsalmpseudpshawpsoaepsoaipsoaspsychpubespubicpubispucespuckapuckspudgypudicpuffspuffypuggypujahpujaspukedpukespukkapuledpulerpulespulikpulispullspulpspulpypulsepumaspumpspunaspunchpungspunkapunkspunkypunnypuntopuntspuntypupaepupalpupaspupilpuppypurdapureepurerpurgepurinpurispurlspurrspursepursypusespushypussyputonputtiputtoputtsputtypygmypyinspylonpyoidpyranpyrespyricpyxespyxiepyxis