5-Letter Words Starting With P
565 5-letter words start with the letter P, including place, point, power, party. Every word below is valid in Scrabble-style word games.
Highest scoring
- pizza25
- pawky17
- phlox17
- prexy17
- proxy17
- pujah17
- pyxes17
- pyxie17
Standard letter values, public-domain ENABLE list, not the official tournament dictionary.
The full list565
pacaspacedpacerpacespachapackspactspaddypadispadlepadrepadripaeanpaeonpaganpagedpagerpagespagodpaikspailspainspaintpairspaisapaisepaleapaledpalerpalespaletpallspallypalmspalmypalpipalpspalsypampapandapandypanedpanelpanespangapangspanicpannepansypantopantspantypapalpapaspapawpaperpappipappyparasparchpardipardspardyparedpareoparerparespareupargepargoparisparkaparksparleparolparrsparryparsepartspartyparveparvopaseopasespashapassepastapastepastspastypatchpatedpatenpaterpatespathspatinpatiopatlypatsypattypausepavanpavedpaverpavespavidpavinpavispawedpawerpawkypawlspawnspaxespayedpayeepayerpayorpeacepeachpeagepeagspeakspeakypealspeanspearlpearspeartpeasepeatspeatypeavypecanpechspeckspeckypedalpedespedropeekspeelspeenspeepspeerspeerypeevepeinspeisepekanpekespekinpekoepelespelfspelonpeltspenalpencependspenespengopenispennapennepennipennypeonspeonypeplapepospeppyperchperduperdypereaperilperisperksperkypermsperrypersepeskypesospestopestspestypetalpeterpetitpettipettopettypeweepewitphagephasephialphloxphonephonophonsphonyphotophotsphphtphutsphylaphylepianopianspibalpicalpicaspickspickypicotpiculpiecepierspietapietypiggypigmypiingpikaspikedpikerpikespikispilafpilarpilaupilawpileapiledpileipilespilispillspilotpiluspimaspimpspinaspinchpinedpinespineypingopingspinkopinkspinkypinnapinnypinonpinotpintapintopintspinuppionspiouspipalpipedpiperpipespipetpipitpiquepirnspirogpiscopisospistepitaspitchpithspithypitonpivotpixelpixespixiepizzaplaceplackplageplaidplainplaitplaneplankplansplantplashplasmplateplatsplatyplayaplaysplazapleadpleaspleatplebeplebsplenaplewsplicapliedplierpliesplinkplodsplonkplopsplotsplotzplowsployspluckplugsplumbplumeplumpplumsplumyplunkplushplyerpoachpockspockypodgypodiapoemspoesypoetspogeypoilupoindpointpoisepokedpokerpokespokeypolarpoledpolerpolespoliopolispolkapollspolospolyppolyspomespommypompsponcepondsponespongspoochpoodspoofspoofypoohspoolspoonspoopspooripoovepopespoppapoppypopsyporchporedporesporgyporksporkypornopornspornyportsposedposerposespositpossepostspotsypottopottypouchpouffpoufspoultpoundpourspoutspoutypowerpoxedpoxespoyoupraamprahupramsprangprankpraosprasepratepratsprausprawnprayspreedpreenpreesprepspresapresepressprestprexypreyspriceprickpricypridepriedprierpriesprigsprillprimaprimeprimiprimoprimpprimsprinkprintprionpriorpriseprismprissprivyprizeproasprobeprodsproemprofsprogsprolepromopromsproneprongproofpropsproseprosoprossprostprosyproudproveprowlprowsproxyprudepruneprutapryerpsalmpseudpshawpsoaepsoaipsoaspsychpubespubicpubispucespuckapuckspudgypudicpuffspuffypuggypujahpujaspukedpukespukkapuledpulerpulespulikpulispullspulpspulpypulsepumaspumpspunaspunchpungspunkapunkspunkypunnypuntopuntspuntypupaepupalpupaspupilpuppypurdapureepurerpurgepurinpurispurlspurrspursepursypusespushypussyputonputtiputtoputtsputtypygmypyinspylonpyoidpyranpyrespyricpyxespyxiepyxis