Skip to content

Word lists

9-Letter Words Starting With H

857 9-letter words start with the letter H, including happening, hopefully, household, happiness. Every word below is valid in Scrabble-style word games.

Highest scoring

  • huzzahing34
  • hizzoners30
  • highjacks29
  • hydrolyze28
  • hypoxemic28
  • haphazard27
  • hemolyzed27
  • hybridize27

Standard letter values, public-domain ENABLE list, not the official tournament dictionary.

The full list857

habanerashabdalahshabergeonhabitablehabitablyhabitantshabituatehabitudeshacendadohachuringhaciendashackamorehackberryhackliesthackneyedhackworkshadrosaurhaecceityhaematicshaematinshaematitehaftarahshaftarothhaftorahshaftorothhagadistshagbusheshagfisheshaggadahshaggadisthaggadothhaggardlyhagiologyhagriddenhagridinghailstonehailstormhairballshairbandshairbrushhairclothhairinesshairlineshairlockshairpiecehairstylehairworkshairwormshalachothhalakistshalationshalazoneshalfbackshalfbeakshalfliveshalfpencehalfpennyhalftimeshalftoneshalidomeshalitoseshalitosishalituseshalliardshallmarkshalloainghallooinghallowershallowinghaloclinehalogetonhalophilehalophytehalothanehalteringhaltinglyhamadryadhamartiashamboninghamburgerhammerershammeringhammertoehamminesshamperershamperinghamstringhamstrunghandballshandbellshandbillshandblownhandbookshandcartshandclasphandcrafthandcuffshandfastshandgripshandheldshandholdshandicapshandinesshandiworkhandlebarhandlingshandlistshandloomshandmaidshandovershandpickshandpresshandprinthandrailshandseledhandshakehandsomerhandspikehandstandhandwheelhandworkshandwovenhandwritehandwrotehangaringhangbirdshangfireshangnailshangnestshangovershankerershankeringhanselinghanselledhaphazardhaphtarashaphtarothaplesslyhaplologyhaplontichaplopiashaplotypehappeninghappinessharanguedharanguerharanguesharassersharassingharbingerharborageharborersharborfulharboringharbouredhardbackshardballshardboardhardbootshardboundhardcoverhardedgeshardenershardeninghardhackshardheadshardihoodhardimenthardinesshardnoseshardshipshardstandhardtackshardwareshardwiredhardwireshardwoodsharebellsharkenersharkeningharlequinharmattanharmfullyharmonicaharmonicsharmoniesharmoniseharmoniumharmonizeharnessedharnessesharpoonedharpoonerharquebusharridansharrowersharrowingharrumphsharshenedharshnesshartshornharumphedharvestedharvesterhashheadshashisheshastenershasteninghastinesshatchablehatchbackhatcheledhatchingshatchlinghatchmenthatchwayshatefullyhatmakershatteriashaughtierhaughtilyhaulmiesthaulyardshausfraushaustellahaustoriahavdalahshavelockshaversackhavockershavockinghawkbillshawkishlyhawkmothshawknoseshawksbillhawkshawshawkweedshawseholehawthornshayfieldshaymakershaystackshazardinghazardoushazelhenshazelnutsheadachesheadbandsheadboardheaddressheadfirstheadgatesheadgearsheadhuntsheadinessheadlampsheadlandsheadlightheadlinedheadlinerheadlinesheadlocksheadnotesheadphoneheadpieceheadracesheadrestsheadroomsheadsailsheadshipsheadspaceheadstallheadstandheadstaysheadstockheadstoneheadwaterheadwindsheadwordsheadworkshealthfulhealthierhealthilyhearkenedheartacheheartbeatheartburnheartenedheartfeltheartiestheartlandheartlessheartsickheartsomeheartsoreheartwoodheartwormheathiestheathlandheathlessheathlikeheatproofheavinesshebdomadshebetatedhebetateshebetudeshebraizedhebraizeshecatombshectogramhectoringhedgehogshedgehopshedgepigshedgerowshedginglyhedonismshedonistsheedfullyheehawingheelballsheelpieceheelpostsheftinesshegemonichegumenesheightensheinouslyheiressesheirloomsheirshipshelicallyhelicoidshelicoptsheliliftsheliostatheliozoanheliportshelistopshellboxeshellbrothhelleborehellenizehellerieshellfireshellholeshellhoundhellishlyhellkiteshelmetinghelminthshelotageshelotismshelotrieshelpfullyhelpmateshelpmeetshemateinshematineshematinichematiteshematitichematomashematuriahemelytrahemicyclehemioliashemiptershemistichhemocoelshemocyteshemolymphhemolyseshemolysinhemolysishemolytichemolyzedhemolyzeshemostatshempseedshempweedshemstitchhendiadyshenequenshenequinshenhousesheniquenshennerieshenpeckedhepaticaehepaticashepatitishepatizedhepatizeshepatomasheptagonsheptarchsheptarchyheraldingherbalistherbariumherbicideherbivoreherbivoryherculeanhereabouthereafterhereawayshereticalhereunderheritableheritageshermetismhermetisthermitagehermitismherniatedherniatesheroinismheroizingheronrieshesitancehesitancyhesitatedhesitaterhesitateshessoniteheterodoxheteronymheterosesheterosisheteroticheuristichexachordhexagonalhexagramshexahedrahexameterhexamineshexaploidhibakushahibernatehiccoughshiccupinghiccuppedhickorieshiddenitehideawayshideboundhideosityhideouslyhidroticshierarchshierarchyhierodulehifalutinhighballshighbrowshighchairhighflierhighflyerhighjackshighlandshighlifeshighlighthighroadshighspotshightailshijackershijackinghilarioushillbillyhillcresthilloainghillsideshimationshindbrainhinderershinderinghindrancehindsighthipnesseshipparchshippiedomhippinesshippocrashiraganashirelingshirselinghirselledhirsutismhispanismhistaminehistaminshistidinehistidinshistogenshistogramhistologyhistorianhistorieshitchhikehizzonershoactzinshoardingshoarfrosthoarinesshoarsenedhoatzineshobbyistshobgoblinhobnailedhobnobbedhobnobberhockshopshocussinghodaddieshodoscopehogfisheshoggishlyhogmanayshogmenayshogsheadshogtieinghogwasheshoideninghokeynessholandricholdbacksholdfastsholdoversholidayedholidayerholleringholloainghollooinghollowarehollowesthollowinghollyhockholocaustholocrinehologramsholographholotypesholotypicholsteinsholsteredholystoneholytideshomeboundhomebredshomebuilthomegrownhomelandshomeliesthomemakerhomeopathhomeownerhomeportshomeroomshomesiteshomespunshomestayshomesteadhometownshomewardshomeworkshomeynesshomicidalhomicideshomiletichomilistshominianshominizedhominizeshominoidshomografthomographhomologuehomolyseshomolysishomolytichomonymichomophilehomophobehomophonehomophonyhomoplasyhomopolarhomosexeshomosporyhomunculihonchoinghonestesthonestieshonewortshoneybeeshoneybunshoneycombhoneydewshoneymoonhonorablehonorablyhonorandshonorariahonorifichonourershonouringhoodooinghoodooismhoodwinkshoofbeatshoofprinthooknoseshookwormshooliganshoopskirthoopstershoorahinghoorayinghoosegowshopefullyhopscotchhorehoundhorizonalhornbeamshornbillshornbookshorninesshornpipeshornpoutshornstonehorntailshornwormshornwortshorologeshoroscopehorribleshorrifiedhorrifieshorsebackhorsebeanhorsecarshorsehairhorsehidehorselesshorselikehorseminthorseplayhorseshithorseshodhorseshoehorsetailhorseweedhorsewhiphorsinesshortativehortatoryhosannaedhosannahshosepipeshosierieshospitalshospitiumhospodarshostelershostelinghostelledhostellerhostessedhostesseshostilelyhostilityhotbloodshotchpotshotdoggedhotdoggerhoteldomshoteliershotfootedhotheadedhothouseshotnesseshourglasshouseboathouseboyshousecarlhousecoathousefulshouseholdhousekeephousekepthouseleekhouselesshouselinghouselledhousemaidhousematehouseroomhousesitshousetopshousewifehouseworkhovellinghowitzershowlinglyhowsoeverhoydeninghoydenishhuaracheshuarachoshubristichuckabackhuckstershuffinesshugeouslyhuisacheshulloainghumanisedhumaniseshumanismshumanistshumanizedhumanizerhumanizeshumankindhumanlikehumannesshumanoidshumbuggedhumdingerhumectanthumiliatehummockedhumongoushumoristshumorlesshumouringhumpbackshumungoushunchbackhundredthhungeringhungriesthunkeringhurrahinghurrayinghurricanehurriedlyhurtfullyhusbandedhusbanderhusbandlyhusbandryhuskinesshuzzahinghyacinthshyalogenshybridismhybridityhybridizehybridomahydathodehydracidshydragogshydrangeahydranthshydratinghydrationhydratorshydraulichydrazidehydrazinehydrocelehydrofoilhydrogelshydrogenshydrolasehydrologyhydrolyzehydromelshydroniumhydropseshydroserehydroskishydrosolshydroxidehydroxylshydrozoanhygieistshygienicshygienisthylozoismhylozoisthymenealshymeniumshymnarieshymnbookshymnodieshymnologyhyoscineshypallagehypanthiahyperacidhyperaridhyperbolahyperbolehypercubehyperemiahyperemichyperfinehypergamyhypergolshyperopeshyperopiahyperopichyperpneahyperpurehypertexthyphemiashyphenatehypheninghypnoidalhypnoticshypnotismhypnotisthypnotizehypoblasthypocausthypocotylhypocrisyhypocritehypodermshypogeoushypomaniahypomanichypomorphhyponoiashypoploidhypopneashypopyonshypostomehypostylehypotaxeshypotaxishypothecshypotoniahypotonichypoxemiahypoxemichyracoidshysteriashystericshysteroid