9-Letter Words Starting With H
857 9-letter words start with the letter H, including happening, hopefully, household, happiness. Every word below is valid in Scrabble-style word games.
Highest scoring
- huzzahing34
- hizzoners30
- highjacks29
- hydrolyze28
- hypoxemic28
- haphazard27
- hemolyzed27
- hybridize27
Standard letter values, public-domain ENABLE list, not the official tournament dictionary.
The full list857
habanerashabdalahshabergeonhabitablehabitablyhabitantshabituatehabitudeshacendadohachuringhaciendashackamorehackberryhackliesthackneyedhackworkshadrosaurhaecceityhaematicshaematinshaematitehaftarahshaftarothhaftorahshaftorothhagadistshagbusheshagfisheshaggadahshaggadisthaggadothhaggardlyhagiologyhagriddenhagridinghailstonehailstormhairballshairbandshairbrushhairclothhairinesshairlineshairlockshairpiecehairstylehairworkshairwormshalachothhalakistshalationshalazoneshalfbackshalfbeakshalfliveshalfpencehalfpennyhalftimeshalftoneshalidomeshalitoseshalitosishalituseshalliardshallmarkshalloainghallooinghallowershallowinghaloclinehalogetonhalophilehalophytehalothanehalteringhaltinglyhamadryadhamartiashamboninghamburgerhammerershammeringhammertoehamminesshamperershamperinghamstringhamstrunghandballshandbellshandbillshandblownhandbookshandcartshandclasphandcrafthandcuffshandfastshandgripshandheldshandholdshandicapshandinesshandiworkhandlebarhandlingshandlistshandloomshandmaidshandovershandpickshandpresshandprinthandrailshandseledhandshakehandsomerhandspikehandstandhandwheelhandworkshandwovenhandwritehandwrotehangaringhangbirdshangfireshangnailshangnestshangovershankerershankeringhanselinghanselledhaphazardhaphtarashaphtarothaplesslyhaplologyhaplontichaplopiashaplotypehappeninghappinessharanguedharanguerharanguesharassersharassingharbingerharborageharborersharborfulharboringharbouredhardbackshardballshardboardhardbootshardboundhardcoverhardedgeshardenershardeninghardhackshardheadshardihoodhardimenthardinesshardnoseshardshipshardstandhardtackshardwareshardwiredhardwireshardwoodsharebellsharkenersharkeningharlequinharmattanharmfullyharmonicaharmonicsharmoniesharmoniseharmoniumharmonizeharnessedharnessesharpoonedharpoonerharquebusharridansharrowersharrowingharrumphsharshenedharshnesshartshornharumphedharvestedharvesterhashheadshashisheshastenershasteninghastinesshatchablehatchbackhatcheledhatchingshatchlinghatchmenthatchwayshatefullyhatmakershatteriashaughtierhaughtilyhaulmiesthaulyardshausfraushaustellahaustoriahavdalahshavelockshaversackhavockershavockinghawkbillshawkishlyhawkmothshawknoseshawksbillhawkshawshawkweedshawseholehawthornshayfieldshaymakershaystackshazardinghazardoushazelhenshazelnutsheadachesheadbandsheadboardheaddressheadfirstheadgatesheadgearsheadhuntsheadinessheadlampsheadlandsheadlightheadlinedheadlinerheadlinesheadlocksheadnotesheadphoneheadpieceheadracesheadrestsheadroomsheadsailsheadshipsheadspaceheadstallheadstandheadstaysheadstockheadstoneheadwaterheadwindsheadwordsheadworkshealthfulhealthierhealthilyhearkenedheartacheheartbeatheartburnheartenedheartfeltheartiestheartlandheartlessheartsickheartsomeheartsoreheartwoodheartwormheathiestheathlandheathlessheathlikeheatproofheavinesshebdomadshebetatedhebetateshebetudeshebraizedhebraizeshecatombshectogramhectoringhedgehogshedgehopshedgepigshedgerowshedginglyhedonismshedonistsheedfullyheehawingheelballsheelpieceheelpostsheftinesshegemonichegumenesheightensheinouslyheiressesheirloomsheirshipshelicallyhelicoidshelicoptsheliliftsheliostatheliozoanheliportshelistopshellboxeshellbrothhelleborehellenizehellerieshellfireshellholeshellhoundhellishlyhellkiteshelmetinghelminthshelotageshelotismshelotrieshelpfullyhelpmateshelpmeetshemateinshematineshematinichematiteshematitichematomashematuriahemelytrahemicyclehemioliashemiptershemistichhemocoelshemocyteshemolymphhemolyseshemolysinhemolysishemolytichemolyzedhemolyzeshemostatshempseedshempweedshemstitchhendiadyshenequenshenequinshenhousesheniquenshennerieshenpeckedhepaticaehepaticashepatitishepatizedhepatizeshepatomasheptagonsheptarchsheptarchyheraldingherbalistherbariumherbicideherbivoreherbivoryherculeanhereabouthereafterhereawayshereticalhereunderheritableheritageshermetismhermetisthermitagehermitismherniatedherniatesheroinismheroizingheronrieshesitancehesitancyhesitatedhesitaterhesitateshessoniteheterodoxheteronymheterosesheterosisheteroticheuristichexachordhexagonalhexagramshexahedrahexameterhexamineshexaploidhibakushahibernatehiccoughshiccupinghiccuppedhickorieshiddenitehideawayshideboundhideosityhideouslyhidroticshierarchshierarchyhierodulehifalutinhighballshighbrowshighchairhighflierhighflyerhighjackshighlandshighlifeshighlighthighroadshighspotshightailshijackershijackinghilarioushillbillyhillcresthilloainghillsideshimationshindbrainhinderershinderinghindrancehindsighthipnesseshipparchshippiedomhippinesshippocrashiraganashirelingshirselinghirselledhirsutismhispanismhistaminehistaminshistidinehistidinshistogenshistogramhistologyhistorianhistorieshitchhikehizzonershoactzinshoardingshoarfrosthoarinesshoarsenedhoatzineshobbyistshobgoblinhobnailedhobnobbedhobnobberhockshopshocussinghodaddieshodoscopehogfisheshoggishlyhogmanayshogmenayshogsheadshogtieinghogwasheshoideninghokeynessholandricholdbacksholdfastsholdoversholidayedholidayerholleringholloainghollooinghollowarehollowesthollowinghollyhockholocaustholocrinehologramsholographholotypesholotypicholsteinsholsteredholystoneholytideshomeboundhomebredshomebuilthomegrownhomelandshomeliesthomemakerhomeopathhomeownerhomeportshomeroomshomesiteshomespunshomestayshomesteadhometownshomewardshomeworkshomeynesshomicidalhomicideshomiletichomilistshominianshominizedhominizeshominoidshomografthomographhomologuehomolyseshomolysishomolytichomonymichomophilehomophobehomophonehomophonyhomoplasyhomopolarhomosexeshomosporyhomunculihonchoinghonestesthonestieshonewortshoneybeeshoneybunshoneycombhoneydewshoneymoonhonorablehonorablyhonorandshonorariahonorifichonourershonouringhoodooinghoodooismhoodwinkshoofbeatshoofprinthooknoseshookwormshooliganshoopskirthoopstershoorahinghoorayinghoosegowshopefullyhopscotchhorehoundhorizonalhornbeamshornbillshornbookshorninesshornpipeshornpoutshornstonehorntailshornwormshornwortshorologeshoroscopehorribleshorrifiedhorrifieshorsebackhorsebeanhorsecarshorsehairhorsehidehorselesshorselikehorseminthorseplayhorseshithorseshodhorseshoehorsetailhorseweedhorsewhiphorsinesshortativehortatoryhosannaedhosannahshosepipeshosierieshospitalshospitiumhospodarshostelershostelinghostelledhostellerhostessedhostesseshostilelyhostilityhotbloodshotchpotshotdoggedhotdoggerhoteldomshoteliershotfootedhotheadedhothouseshotnesseshourglasshouseboathouseboyshousecarlhousecoathousefulshouseholdhousekeephousekepthouseleekhouselesshouselinghouselledhousemaidhousematehouseroomhousesitshousetopshousewifehouseworkhovellinghowitzershowlinglyhowsoeverhoydeninghoydenishhuaracheshuarachoshubristichuckabackhuckstershuffinesshugeouslyhuisacheshulloainghumanisedhumaniseshumanismshumanistshumanizedhumanizerhumanizeshumankindhumanlikehumannesshumanoidshumbuggedhumdingerhumectanthumiliatehummockedhumongoushumoristshumorlesshumouringhumpbackshumungoushunchbackhundredthhungeringhungriesthunkeringhurrahinghurrayinghurricanehurriedlyhurtfullyhusbandedhusbanderhusbandlyhusbandryhuskinesshuzzahinghyacinthshyalogenshybridismhybridityhybridizehybridomahydathodehydracidshydragogshydrangeahydranthshydratinghydrationhydratorshydraulichydrazidehydrazinehydrocelehydrofoilhydrogelshydrogenshydrolasehydrologyhydrolyzehydromelshydroniumhydropseshydroserehydroskishydrosolshydroxidehydroxylshydrozoanhygieistshygienicshygienisthylozoismhylozoisthymenealshymeniumshymnarieshymnbookshymnodieshymnologyhyoscineshypallagehypanthiahyperacidhyperaridhyperbolahyperbolehypercubehyperemiahyperemichyperfinehypergamyhypergolshyperopeshyperopiahyperopichyperpneahyperpurehypertexthyphemiashyphenatehypheninghypnoidalhypnoticshypnotismhypnotisthypnotizehypoblasthypocausthypocotylhypocrisyhypocritehypodermshypogeoushypomaniahypomanichypomorphhyponoiashypoploidhypopneashypopyonshypostomehypostylehypotaxeshypotaxishypothecshypotoniahypotonichypoxemiahypoxemichyracoidshysteriashystericshysteroid