9-Letter Words Starting With T
1,200 9-letter words start with the letter T, including treatment, therefore, thousands, technical. Every word below is valid in Scrabble-style word games.
Highest scoring
- terrazzos27
- tzaritzas27
- tzaddikim26
- texturize25
- toxophily24
- tchotchke23
- technique23
- throwback23
Standard letter values, public-domain ENABLE list, not the official tournament dictionary.
The full list1,200
tabboulehtablaturetablefulstablelandtablematetablesfultabletingtabletopstablettedtablewaretabooleystaborinestabourerstabouretstabouringtabulatedtabulatestabulatortacamahactachinidstachismestachistestacitnesstackboardtackifiedtackifiertackifiestackinesstacklingstaconitestactfullytacticiantactilelytactilitytactuallytaeniasestaeniasistaffarelstafferelstaffrailstagalongstagboardstailbackstailboardtailbonestailcoatstailendertailgatedtailgatertailgatestaillampstailleurstaillighttailoringtailpiecetailpipestailplanetailracestailskidstailslidetailspinstailwatertailwindstaintlesstakedownstakeoverstalapoinstalismanstalkathontalkativetalkfeststalkinesstallagingtallaisimtallithestallithimtallitothtallowingtallyhoedtalmudismtamanduastamarackstamarillotamarindstamariskstambourastambouredtambourertamoxifentampererstamperingtamponingtangencestangerinetangiblestangliesttankshipstanneriestantalatetantalisetantalitetantalizetantalumstantiviestanzanitetapaderastapaderostapelinestapewormstaphonomytaphousestarantismtarantulatarbushestardinesstargetingtariffingtarlatanstarletanstarnationtarnishedtarnishestarpaperstarpaulintarragonstarriancetartratestartuffestaskworkstasselingtasselledtastelesstastinesstatteringtattinesstattooerstattooingtattooisttauteningtautologytautomerstautonymstautonymytavernerstawdriesttawninesstaxationstaxidermytaximetertaxonomictaxpayerstaxpayingtchotchketeaboardsteachableteachablyteacherlyteachingsteacupfulteahousesteakettleteakwoodsteamakersteammatesteamstersteamworkstearawaysteardownsteardropstearfullyteargasestearstainteaselersteaselingteaselledteasinglyteaspoonsteazelingteazelledtechnicaltechniquetectonicstectonismtectricestediouslyteeminglyteenagersteensiestteentsierteeteringteethingsteetotalsteetotumstegmentaltegmentumtegumentstelamonestelecaststelefilmstelegenictelegramstelegraphtelemarkstelemetertelemetryteleologyteleonomytelepathstelepathytelephonetelephonytelephototeleplaysteleportstelescopetelesticsteletextstelethonsteleviewstelevisedtelevisestelferingtelicallytellinglytelltalestelluridetelluriumtelomerestelophasetelotaxestelotaxistelpheredtemblorestemperatetempererstemperingtempestedtemplatestemporalstemporarytemporisetemporizetemptabletemptresstenacioustenaculumtenaillestenanciestenantingtendancestendencestendererstenderesttenderingtenderizetendinoustendressetendriledtenebrismtenebristtenebroustenementstenoriststenoritestenpencestensenesstensilitytensionaltensionedtensionertensitiestentacledtentaclestentativetenteringtenuitiestenuouslytenurableteocallisteosintestepefyingtephritestepidnessteratismsteratogenteratomasterawattsterceletsterebenesterebinthteredinesteriyakistermagantterminalsterminatetermitarytermtimesternariesternatelyterpenoidterpineolterpinolsterracingterraformterrapinsterrariumterrazzosterrellasterrifiedterrifiesterritoryterroriseterrorismterroristterrorizetersenesstervalenttesseracttessituratestaciestestamenttestatorstestatrixtestcrosstesticlestestifiedtestifiertestifiestestimonytestinesstetanisedtetanisestetanizedtetanizestetanusestetchiesttetheringtetracidstetragonstetralogytetramerstetrapodstetrarchstetrarchytetroxidetetroxidsteutonizetextbookstextuallytexturingtexturizethalassicthalliumsthallusesthaneshipthanklessthatchersthatchierthatchingtheatricsthebainesthecodontthematicstheocracytheocratstheogonictheologictheologuetheophanytheoretictheorisedtheorisestheoriststheorizedtheorizertheorizestheosophytherapiestherapisttherapsidthereforetherefromthereintothereminsthereuntothereupontherewiththeriacaltheriacasthermallythermionsthermitesthermosesthermosettheropodsthesauralthesaurusthespianstheurgiestheurgistthiaminesthiazidesthiazinesthiazolesthickenedthickenerthicketedthickheadthicknessthicksetsthighbonethincladsthindownsthingnessthingummythinkablethinkablythinkingsthionatesthioninesthiophenethiophensthiotepasthioureasthirdhandthirlagesthirstersthirstierthirstilythirstingthirteensthirtieththirtyishthistlierthithertotholeiitetholepinsthornbackthornbushthorniestthornlessthornlikethousandsthraldomsthralldomthrallingthrashersthrashingthreadersthreadfinthreadierthreadingthreapersthreapingthreatensthreatingthreefoldthreepingthreesomethrenodesthrenodicthreoninethreshersthreshingthresholdthriftierthriftilythrillersthrillingthroatierthroatilythroatingthrobbersthrobbingthrombinsthrongingthrostlesthrottledthrottlerthrottlesthroughlythrowawaythrowbackthrowsterthrummersthrummierthrummingthrustersthrustfulthrustingthrustorsthumbholethumbkinsthumbnailthumbnutsthumbtackthunderedthundererthuriblesthurifersthwackersthwackingthwartersthwartingthylacinethylakoidthymidinethymocytethymosinsthyratronthyristorthyroidalthyroxinethyroxinsticketingtickseedsticktacksticktockstictackedtictockedtidelandstidemarkstidewatertieclaspstiffaniestiffiningtigereyestigerliketightenedtightenertightnesstightropetightwadstightwiretigressestilburiestilleringtillermantillermentiltmetertiltyardstimberingtimbermantimbermentimecardstimeliesttimelinestimeouslytimepiecetimesavertimescaletimetabletimeworkstimidnesstimocracytimothiestimpanisttimpanumstincturedtincturestinderboxtingliesttinkererstinkeringtinkliesttinklingstinninesstinplatestinselingtinselledtinsmithstinstonestippytoedtippytoestipsinesstipstaffstipstavestipstockstiptoeingtiramisustirednesstirriveestitanatestitanismstitanitestitaniumstithoniastitillatetitivatedtitivatestitratingtitrationtitratorstittererstitteringtittivatetittupingtittuppedtitularlytoadeatertoadstonetoadstooltoadyismstoastiesttobaccoestobogganstocheringtoenailedtoepiecestoeplatestoggeriestoiletingtoilettestoilfullytokenismstokonomastolboothstolerabletolerablytolerancetoleratedtoleratestoleratortolidinestollboothtollgatestollhousetoluidinetoluidinstomahawkstomalleystomatillotomboyishtombstonetomcattedtomentosetommyrotstomogramstomorrowstonguingstonicallytonometertonometrytonoplasttonsillartonsorialtonsuringtoolboxestoolheadstoolhousetoolmakertoolroomstoolshedstoothachetoothiesttoothlesstoothliketoothpicktoothsometoothworttopflighttopiariestopicallytopminnowtoponymictopotypestopsiderstopsoiledtopstitchtopstonestopworkedtorcherestorchierstorchiesttorchwoodtoreadorstoreuticstormentedtormentertormentiltormentortornadoestornillostorpedoedtorpedoestorpiditytorquesestorrefiedtorrefiestorridesttorriditytorrifiedtorrifiestorsionaltortillastortoisestortricidtortrixestorturerstorturingtorturoustotalisedtotalisestotalismstotaliststotalizedtotalizertotalizestotallingtotemismstotemiststotemitestottererstotteringtouchabletouchbacktouchdowntouchholetouchiesttouchlinetouchmarktouchwoodtoughenedtoughnesstouristictournedostourneyedtowelettetowelingstowellingtoweriesttowerliketowheadedtownhomestownhousetownscapetownsfolktownshipstoxaemiastoxaphenetoxicantstoxicosestoxicosistoxigenictoxophilytrabeatedtrabeculatraceabletracelesstraceriedtraceriestrachearytracheatetracheidstracheoletrachlingtrachomastrachytestrachytictrackagestrackballtrackingstracklesstracksidetracksuittrackwaystractabletractablytractatestractionstradeabletrademarktradeoffstradesmantradesmentraditiontraducerstraducingtragediantragediestragopanstraileredtrailheadtraillesstrailsidetrainabletrainbandtrainfulstrainingstrainloadtrainwaystraipsingtraitresstrajectedtramelingtramelledtramlinestrammeledtramplerstramplingtramroadstransactstransaxletranscendtransducetransectstranseptstransfecttransferstransfixttransformtransfusetranshipstransienttransitedtranslatetransmitstransmutetransonictranspiretransporttransposetransshiptransudedtransudestrapannedtrapballstrapdoorstrapesingtrapezisttrapeziumtrapeziustrapezoidtraplinestrapneststrappingstraprockstrapuntostrashiesttrattoriatrattorietrauchledtrauchlestraumatictravailedtravelerstravelingtravelledtravellertravelogstraversaltraversedtraversertraversestravoisestrawlnetstreacherytreadlerstreadlesstreadlingtreadmilltreasuredtreasurertreasurestreatabletreatisestreatmenttrebuchettrebuckettrecentostreddlingtreelawnstreenailstreenwaretrehalosetreillagetrellisedtrellisestrematodetremblerstrembliertremblingtremolitetremulanttremuloustrenchanttrencherstrenchingtrendiesttrepannedtrephinedtrephinestrepidanttreponematreponemetressiesttressourstressurestretinointriadismstrialoguetrianglestriathlontriatomictriazinestriazolestribalismtribesmantribesmentribologytribrachstribulatetribunalstribunatetributarytricepsestrichinaetrichinaltrichinastrichitestrichomestrickiesttrickliertricklingtricksiertrickstertricliniatriclinictricolorstricornestricotinetrictracstricuspidtricyclestricyclictriennialtrienniumtrierarchtrifectastriflingstrifocalstrifoliumtriforiumtriggeredtriglyphstrigraphstrihedraltrihedrontrihybridtrilineartrillionstrilliumstrilobatetrilobitetrilogiestrimaranstrimeroustrimestertrimeterstrimmingstrimorphstrimotorstrindlingtrinitiestrinketedtrinketertrinketrytrinomialtrioxidestriplanestriplexestriplitestriploidstriploidytripodiestrippiesttrippingstriptanestriptycastriptychstripwirestriscelestrisectedtrisectortriskelestrismusestrisomicstrisomiestristezastristichstritenesstritheismtritheisttrithingstritiatedtriticaletriticumstrituratetriumphaltriumphedtriumviritriumvirstrivalenttrivalvestriviallytriweeklytrochaicstrochilustrochleaetrochleartrochleastrochoidstroilismstroilitestroilusestrolleyedtrollingstrollyingtrombonestroopialstroopshiptrophyingtropistictroponinstrotlinestroublerstroublingtroubloustrouncerstrouncingtroupialstrousseautroutiesttrouverestrouveurstrowelerstrowelingtrowelledtruanciestruantingtruckagestruckfulstruckingstrucklerstrucklinetrucklingtruckloadtruculenttrudgeonstruebluestruelovestruepennytrumpetedtrumpetertruncatedtruncatestruncheontrundlerstrundlingtrunkfishtrunkfulstrunksfultrunnionstrussingstrustabletrustiesttrustlesstsarevnastsaritzastsimmesestsktskingtubenosestuberclestuberosestubeworkstubifexestubificidtubulatedtubulatestubulurestuckahoestuckeringtuckshopstufaceoustuitionaltularemiatularemictulipwoodtullibeestumblebugtumblingstumefyingtumescenttumorliketumplinestumulusestundishestunefullytunesmithtungstatetungstenstunicatedtunicatestunnelerstunnelingtunnelledtuppencesturbannedturbariesturbiditeturbidityturbinalsturbinateturbocarsturbofansturbojetsturbopropturbulentturgidityturkoisesturmericsturmoiledturnaboutturncoatsturndownsturneriesturnhallsturnoversturnpikesturnsolesturnspitsturnstileturnstoneturntableturophileturpitudeturquoiseturtlingstutelagestutoragestutorialstutorshiptutoyeredtwaddlerstwaddlingtwangiesttwanglerstwanglingtwattlingtwaybladetweakiesttweediesttweedlingtwelvemostwentiethtwiddlerstwiddliertwiddlingtwiggiesttwilightstwillingstwinberrytwingeingtwinklerstwinklingtwinningstwinshipstwirliesttwistiesttwistingstwitcherstwitchiertwitchilytwitchingtwitteredtwopencestympaniestympanisttympanumstypecasestypecaststypefacestypestyletypewritetypewrotetypicallytypifierstypifyingtypographtyraminestyranniestyrannisetyrannizetyrannoustyrocidintyrosinestzaddikimtzarevnastzaritzastzimmeses