Skip to content

Word lists

9-Letter Words Starting With T

1,200 9-letter words start with the letter T, including treatment, therefore, thousands, technical. Every word below is valid in Scrabble-style word games.

Highest scoring

  • terrazzos27
  • tzaritzas27
  • tzaddikim26
  • texturize25
  • toxophily24
  • tchotchke23
  • technique23
  • throwback23

Standard letter values, public-domain ENABLE list, not the official tournament dictionary.

The full list1,200

tabboulehtablaturetablefulstablelandtablematetablesfultabletingtabletopstablettedtablewaretabooleystaborinestabourerstabouretstabouringtabulatedtabulatestabulatortacamahactachinidstachismestachistestacitnesstackboardtackifiedtackifiertackifiestackinesstacklingstaconitestactfullytacticiantactilelytactilitytactuallytaeniasestaeniasistaffarelstafferelstaffrailstagalongstagboardstailbackstailboardtailbonestailcoatstailendertailgatedtailgatertailgatestaillampstailleurstaillighttailoringtailpiecetailpipestailplanetailracestailskidstailslidetailspinstailwatertailwindstaintlesstakedownstakeoverstalapoinstalismanstalkathontalkativetalkfeststalkinesstallagingtallaisimtallithestallithimtallitothtallowingtallyhoedtalmudismtamanduastamarackstamarillotamarindstamariskstambourastambouredtambourertamoxifentampererstamperingtamponingtangencestangerinetangiblestangliesttankshipstanneriestantalatetantalisetantalitetantalizetantalumstantiviestanzanitetapaderastapaderostapelinestapewormstaphonomytaphousestarantismtarantulatarbushestardinesstargetingtariffingtarlatanstarletanstarnationtarnishedtarnishestarpaperstarpaulintarragonstarriancetartratestartuffestaskworkstasselingtasselledtastelesstastinesstatteringtattinesstattooerstattooingtattooisttauteningtautologytautomerstautonymstautonymytavernerstawdriesttawninesstaxationstaxidermytaximetertaxonomictaxpayerstaxpayingtchotchketeaboardsteachableteachablyteacherlyteachingsteacupfulteahousesteakettleteakwoodsteamakersteammatesteamstersteamworkstearawaysteardownsteardropstearfullyteargasestearstainteaselersteaselingteaselledteasinglyteaspoonsteazelingteazelledtechnicaltechniquetectonicstectonismtectricestediouslyteeminglyteenagersteensiestteentsierteeteringteethingsteetotalsteetotumstegmentaltegmentumtegumentstelamonestelecaststelefilmstelegenictelegramstelegraphtelemarkstelemetertelemetryteleologyteleonomytelepathstelepathytelephonetelephonytelephototeleplaysteleportstelescopetelesticsteletextstelethonsteleviewstelevisedtelevisestelferingtelicallytellinglytelltalestelluridetelluriumtelomerestelophasetelotaxestelotaxistelpheredtemblorestemperatetempererstemperingtempestedtemplatestemporalstemporarytemporisetemporizetemptabletemptresstenacioustenaculumtenaillestenanciestenantingtendancestendencestendererstenderesttenderingtenderizetendinoustendressetendriledtenebrismtenebristtenebroustenementstenoriststenoritestenpencestensenesstensilitytensionaltensionedtensionertensitiestentacledtentaclestentativetenteringtenuitiestenuouslytenurableteocallisteosintestepefyingtephritestepidnessteratismsteratogenteratomasterawattsterceletsterebenesterebinthteredinesteriyakistermagantterminalsterminatetermitarytermtimesternariesternatelyterpenoidterpineolterpinolsterracingterraformterrapinsterrariumterrazzosterrellasterrifiedterrifiesterritoryterroriseterrorismterroristterrorizetersenesstervalenttesseracttessituratestaciestestamenttestatorstestatrixtestcrosstesticlestestifiedtestifiertestifiestestimonytestinesstetanisedtetanisestetanizedtetanizestetanusestetchiesttetheringtetracidstetragonstetralogytetramerstetrapodstetrarchstetrarchytetroxidetetroxidsteutonizetextbookstextuallytexturingtexturizethalassicthalliumsthallusesthaneshipthanklessthatchersthatchierthatchingtheatricsthebainesthecodontthematicstheocracytheocratstheogonictheologictheologuetheophanytheoretictheorisedtheorisestheoriststheorizedtheorizertheorizestheosophytherapiestherapisttherapsidthereforetherefromthereintothereminsthereuntothereupontherewiththeriacaltheriacasthermallythermionsthermitesthermosesthermosettheropodsthesauralthesaurusthespianstheurgiestheurgistthiaminesthiazidesthiazinesthiazolesthickenedthickenerthicketedthickheadthicknessthicksetsthighbonethincladsthindownsthingnessthingummythinkablethinkablythinkingsthionatesthioninesthiophenethiophensthiotepasthioureasthirdhandthirlagesthirstersthirstierthirstilythirstingthirteensthirtieththirtyishthistlierthithertotholeiitetholepinsthornbackthornbushthorniestthornlessthornlikethousandsthraldomsthralldomthrallingthrashersthrashingthreadersthreadfinthreadierthreadingthreapersthreapingthreatensthreatingthreefoldthreepingthreesomethrenodesthrenodicthreoninethreshersthreshingthresholdthriftierthriftilythrillersthrillingthroatierthroatilythroatingthrobbersthrobbingthrombinsthrongingthrostlesthrottledthrottlerthrottlesthroughlythrowawaythrowbackthrowsterthrummersthrummierthrummingthrustersthrustfulthrustingthrustorsthumbholethumbkinsthumbnailthumbnutsthumbtackthunderedthundererthuriblesthurifersthwackersthwackingthwartersthwartingthylacinethylakoidthymidinethymocytethymosinsthyratronthyristorthyroidalthyroxinethyroxinsticketingtickseedsticktacksticktockstictackedtictockedtidelandstidemarkstidewatertieclaspstiffaniestiffiningtigereyestigerliketightenedtightenertightnesstightropetightwadstightwiretigressestilburiestilleringtillermantillermentiltmetertiltyardstimberingtimbermantimbermentimecardstimeliesttimelinestimeouslytimepiecetimesavertimescaletimetabletimeworkstimidnesstimocracytimothiestimpanisttimpanumstincturedtincturestinderboxtingliesttinkererstinkeringtinkliesttinklingstinninesstinplatestinselingtinselledtinsmithstinstonestippytoedtippytoestipsinesstipstaffstipstavestipstockstiptoeingtiramisustirednesstirriveestitanatestitanismstitanitestitaniumstithoniastitillatetitivatedtitivatestitratingtitrationtitratorstittererstitteringtittivatetittupingtittuppedtitularlytoadeatertoadstonetoadstooltoadyismstoastiesttobaccoestobogganstocheringtoenailedtoepiecestoeplatestoggeriestoiletingtoilettestoilfullytokenismstokonomastolboothstolerabletolerablytolerancetoleratedtoleratestoleratortolidinestollboothtollgatestollhousetoluidinetoluidinstomahawkstomalleystomatillotomboyishtombstonetomcattedtomentosetommyrotstomogramstomorrowstonguingstonicallytonometertonometrytonoplasttonsillartonsorialtonsuringtoolboxestoolheadstoolhousetoolmakertoolroomstoolshedstoothachetoothiesttoothlesstoothliketoothpicktoothsometoothworttopflighttopiariestopicallytopminnowtoponymictopotypestopsiderstopsoiledtopstitchtopstonestopworkedtorcherestorchierstorchiesttorchwoodtoreadorstoreuticstormentedtormentertormentiltormentortornadoestornillostorpedoedtorpedoestorpiditytorquesestorrefiedtorrefiestorridesttorriditytorrifiedtorrifiestorsionaltortillastortoisestortricidtortrixestorturerstorturingtorturoustotalisedtotalisestotalismstotaliststotalizedtotalizertotalizestotallingtotemismstotemiststotemitestottererstotteringtouchabletouchbacktouchdowntouchholetouchiesttouchlinetouchmarktouchwoodtoughenedtoughnesstouristictournedostourneyedtowelettetowelingstowellingtoweriesttowerliketowheadedtownhomestownhousetownscapetownsfolktownshipstoxaemiastoxaphenetoxicantstoxicosestoxicosistoxigenictoxophilytrabeatedtrabeculatraceabletracelesstraceriedtraceriestrachearytracheatetracheidstracheoletrachlingtrachomastrachytestrachytictrackagestrackballtrackingstracklesstracksidetracksuittrackwaystractabletractablytractatestractionstradeabletrademarktradeoffstradesmantradesmentraditiontraducerstraducingtragediantragediestragopanstraileredtrailheadtraillesstrailsidetrainabletrainbandtrainfulstrainingstrainloadtrainwaystraipsingtraitresstrajectedtramelingtramelledtramlinestrammeledtramplerstramplingtramroadstransactstransaxletranscendtransducetransectstranseptstransfecttransferstransfixttransformtransfusetranshipstransienttransitedtranslatetransmitstransmutetransonictranspiretransporttransposetransshiptransudedtransudestrapannedtrapballstrapdoorstrapesingtrapezisttrapeziumtrapeziustrapezoidtraplinestrapneststrappingstraprockstrapuntostrashiesttrattoriatrattorietrauchledtrauchlestraumatictravailedtravelerstravelingtravelledtravellertravelogstraversaltraversedtraversertraversestravoisestrawlnetstreacherytreadlerstreadlesstreadlingtreadmilltreasuredtreasurertreasurestreatabletreatisestreatmenttrebuchettrebuckettrecentostreddlingtreelawnstreenailstreenwaretrehalosetreillagetrellisedtrellisestrematodetremblerstrembliertremblingtremolitetremulanttremuloustrenchanttrencherstrenchingtrendiesttrepannedtrephinedtrephinestrepidanttreponematreponemetressiesttressourstressurestretinointriadismstrialoguetrianglestriathlontriatomictriazinestriazolestribalismtribesmantribesmentribologytribrachstribulatetribunalstribunatetributarytricepsestrichinaetrichinaltrichinastrichitestrichomestrickiesttrickliertricklingtricksiertrickstertricliniatriclinictricolorstricornestricotinetrictracstricuspidtricyclestricyclictriennialtrienniumtrierarchtrifectastriflingstrifocalstrifoliumtriforiumtriggeredtriglyphstrigraphstrihedraltrihedrontrihybridtrilineartrillionstrilliumstrilobatetrilobitetrilogiestrimaranstrimeroustrimestertrimeterstrimmingstrimorphstrimotorstrindlingtrinitiestrinketedtrinketertrinketrytrinomialtrioxidestriplanestriplexestriplitestriploidstriploidytripodiestrippiesttrippingstriptanestriptycastriptychstripwirestriscelestrisectedtrisectortriskelestrismusestrisomicstrisomiestristezastristichstritenesstritheismtritheisttrithingstritiatedtriticaletriticumstrituratetriumphaltriumphedtriumviritriumvirstrivalenttrivalvestriviallytriweeklytrochaicstrochilustrochleaetrochleartrochleastrochoidstroilismstroilitestroilusestrolleyedtrollingstrollyingtrombonestroopialstroopshiptrophyingtropistictroponinstrotlinestroublerstroublingtroubloustrouncerstrouncingtroupialstrousseautroutiesttrouverestrouveurstrowelerstrowelingtrowelledtruanciestruantingtruckagestruckfulstruckingstrucklerstrucklinetrucklingtruckloadtruculenttrudgeonstruebluestruelovestruepennytrumpetedtrumpetertruncatedtruncatestruncheontrundlerstrundlingtrunkfishtrunkfulstrunksfultrunnionstrussingstrustabletrustiesttrustlesstsarevnastsaritzastsimmesestsktskingtubenosestuberclestuberosestubeworkstubifexestubificidtubulatedtubulatestubulurestuckahoestuckeringtuckshopstufaceoustuitionaltularemiatularemictulipwoodtullibeestumblebugtumblingstumefyingtumescenttumorliketumplinestumulusestundishestunefullytunesmithtungstatetungstenstunicatedtunicatestunnelerstunnelingtunnelledtuppencesturbannedturbariesturbiditeturbidityturbinalsturbinateturbocarsturbofansturbojetsturbopropturbulentturgidityturkoisesturmericsturmoiledturnaboutturncoatsturndownsturneriesturnhallsturnoversturnpikesturnsolesturnspitsturnstileturnstoneturntableturophileturpitudeturquoiseturtlingstutelagestutoragestutorialstutorshiptutoyeredtwaddlerstwaddlingtwangiesttwanglerstwanglingtwattlingtwaybladetweakiesttweediesttweedlingtwelvemostwentiethtwiddlerstwiddliertwiddlingtwiggiesttwilightstwillingstwinberrytwingeingtwinklerstwinklingtwinningstwinshipstwirliesttwistiesttwistingstwitcherstwitchiertwitchilytwitchingtwitteredtwopencestympaniestympanisttympanumstypecasestypecaststypefacestypestyletypewritetypewrotetypicallytypifierstypifyingtypographtyraminestyranniestyrannisetyrannizetyrannoustyrocidintyrosinestzaddikimtzarevnastzaritzastzimmeses